ll 37 peptide Search Results


human ll37  (Shanghai Korain Biotech Co Ltd)
94
Shanghai Korain Biotech Co Ltd human ll37
Human Ll37, supplied by Shanghai Korain Biotech Co Ltd, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/human ll37/product/Shanghai Korain Biotech Co Ltd
Average 94 stars, based on 1 article reviews
human ll37 - by Bioz Stars, 2026-03
94/100 stars
  Buy from Supplier
csb e14948h  (Cusabio)
93
Cusabio csb e14948h
Csb E14948h, supplied by Cusabio, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/csb e14948h/product/Cusabio
Average 93 stars, based on 1 article reviews
csb e14948h - by Bioz Stars, 2026-03
93/100 stars
  Buy from Supplier
fluorescein conjugated cathelicidin antimicrobial peptide ll 37  (Rockland Immunochemicals)
93
Rockland Immunochemicals fluorescein conjugated cathelicidin antimicrobial peptide ll 37
Fluorescein Conjugated Cathelicidin Antimicrobial Peptide Ll 37, supplied by Rockland Immunochemicals, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/fluorescein conjugated cathelicidin antimicrobial peptide ll 37/product/Rockland Immunochemicals
Average 93 stars, based on 1 article reviews
fluorescein conjugated cathelicidin antimicrobial peptide ll 37 - by Bioz Stars, 2026-03
93/100 stars
  Buy from Supplier
ll-37  (Peptide Specialty Laboratories)
90
Peptide Specialty Laboratories ll-37
Ll 37, supplied by Peptide Specialty Laboratories, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/ll-37/product/Peptide Specialty Laboratories
Average 90 stars, based on 1 article reviews
ll-37 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier
synthetic peptides for ll-37  (Peptide Institute)
90
Peptide Institute synthetic peptides for ll-37
Synthetic Peptides For Ll 37, supplied by Peptide Institute, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/synthetic peptides for ll-37/product/Peptide Institute
Average 90 stars, based on 1 article reviews
synthetic peptides for ll-37 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier
human ll-37 peptide  (PANATec GmbH)
90
PANATec GmbH human ll-37 peptide
Human Ll 37 Peptide, supplied by PANATec GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/human ll-37 peptide/product/PANATec GmbH
Average 90 stars, based on 1 article reviews
human ll-37 peptide - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier
ll-37  (American Peptide Company Inc)
90
American Peptide Company Inc ll-37
Ll 37, supplied by American Peptide Company Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/ll-37/product/American Peptide Company Inc
Average 90 stars, based on 1 article reviews
ll-37 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier
human cathelicidin cap18/ll-37-derived antimicrobial peptides  (Heumann Pharma)
90
Heumann Pharma human cathelicidin cap18/ll-37-derived antimicrobial peptides
Human Cathelicidin Cap18/Ll 37 Derived Antimicrobial Peptides, supplied by Heumann Pharma, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/human cathelicidin cap18/ll-37-derived antimicrobial peptides/product/Heumann Pharma
Average 90 stars, based on 1 article reviews
human cathelicidin cap18/ll-37-derived antimicrobial peptides - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier
ll37 peptide  (SynPep Corporation)
90
SynPep Corporation ll37 peptide
Ll37 Peptide, supplied by SynPep Corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/ll37 peptide/product/SynPep Corporation
Average 90 stars, based on 1 article reviews
ll37 peptide - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier
ll-37 ([LL-37, 37 aa]  (Peptide 2.0 Inc)
90
Peptide 2.0 Inc ll-37 ([LL-37, 37 aa]
Decrease of Pseudomonas aeruginosa Xen5 luminescence (indicative of decreased viability) after 8 hours of incubation with cathelicidin <t>LL-37</t> ( A ), ceragenin CSA-13 ( B ), polymyxin B ( C ), tobramycin ( D ), colistin ( E ), and aztreonam ( F ) or their combination with DNase 1, p-ASP or DNase 1/p-ASP assessed in individual samples of 1:10 dilution of cystic fibrosis sputum. Error bars represent standard deviations from eight different sputum samples (n=8). *Statistically significant ( p <0.05) compared to control. Abbreviation: p-ASP, poly-(d,l)-aspartic acid.
Ll 37 ([LL-37, 37 aa], supplied by Peptide 2.0 Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/ll-37 ([LL-37, 37 aa]/product/Peptide 2.0 Inc
Average 90 stars, based on 1 article reviews
ll-37 ([LL-37, 37 aa] - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier
human anti-microbial peptide ll-37  (Leidos Biomedical)
90
Leidos Biomedical human anti-microbial peptide ll-37
Decrease of Pseudomonas aeruginosa Xen5 luminescence (indicative of decreased viability) after 8 hours of incubation with cathelicidin <t>LL-37</t> ( A ), ceragenin CSA-13 ( B ), polymyxin B ( C ), tobramycin ( D ), colistin ( E ), and aztreonam ( F ) or their combination with DNase 1, p-ASP or DNase 1/p-ASP assessed in individual samples of 1:10 dilution of cystic fibrosis sputum. Error bars represent standard deviations from eight different sputum samples (n=8). *Statistically significant ( p <0.05) compared to control. Abbreviation: p-ASP, poly-(d,l)-aspartic acid.
Human Anti Microbial Peptide Ll 37, supplied by Leidos Biomedical, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/human anti-microbial peptide ll-37/product/Leidos Biomedical
Average 90 stars, based on 1 article reviews
human anti-microbial peptide ll-37 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier
antibacterial peptide ll-37 cqa1065  (Cohesion Biosciences)
90
Cohesion Biosciences antibacterial peptide ll-37 cqa1065
Decrease of Pseudomonas aeruginosa Xen5 luminescence (indicative of decreased viability) after 8 hours of incubation with cathelicidin <t>LL-37</t> ( A ), ceragenin CSA-13 ( B ), polymyxin B ( C ), tobramycin ( D ), colistin ( E ), and aztreonam ( F ) or their combination with DNase 1, p-ASP or DNase 1/p-ASP assessed in individual samples of 1:10 dilution of cystic fibrosis sputum. Error bars represent standard deviations from eight different sputum samples (n=8). *Statistically significant ( p <0.05) compared to control. Abbreviation: p-ASP, poly-(d,l)-aspartic acid.
Antibacterial Peptide Ll 37 Cqa1065, supplied by Cohesion Biosciences, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/antibacterial peptide ll-37 cqa1065/product/Cohesion Biosciences
Average 90 stars, based on 1 article reviews
antibacterial peptide ll-37 cqa1065 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

Image Search Results


Decrease of Pseudomonas aeruginosa Xen5 luminescence (indicative of decreased viability) after 8 hours of incubation with cathelicidin LL-37 ( A ), ceragenin CSA-13 ( B ), polymyxin B ( C ), tobramycin ( D ), colistin ( E ), and aztreonam ( F ) or their combination with DNase 1, p-ASP or DNase 1/p-ASP assessed in individual samples of 1:10 dilution of cystic fibrosis sputum. Error bars represent standard deviations from eight different sputum samples (n=8). *Statistically significant ( p <0.05) compared to control. Abbreviation: p-ASP, poly-(d,l)-aspartic acid.

Journal: Infection and Drug Resistance

Article Title: Targeting polyelectrolyte networks in purulent body fluids to modulate bactericidal properties of some antibiotics

doi: 10.2147/IDR.S145337

Figure Lengend Snippet: Decrease of Pseudomonas aeruginosa Xen5 luminescence (indicative of decreased viability) after 8 hours of incubation with cathelicidin LL-37 ( A ), ceragenin CSA-13 ( B ), polymyxin B ( C ), tobramycin ( D ), colistin ( E ), and aztreonam ( F ) or their combination with DNase 1, p-ASP or DNase 1/p-ASP assessed in individual samples of 1:10 dilution of cystic fibrosis sputum. Error bars represent standard deviations from eight different sputum samples (n=8). *Statistically significant ( p <0.05) compared to control. Abbreviation: p-ASP, poly-(d,l)-aspartic acid.

Article Snippet: LL-37 ([LL-37, 37 aa]) was purchased from Peptide 2.0 Inc. (Chantilly, VA, USA).

Techniques: Incubation

Pseudomonas aeruginosa Xen5 biofilm mass formed after 24 hours growth in LB medium containing cathelicidin LL-37 ( A ), ceragenin CSA-13 ( B ), polymyxin B ( C ), tobramycin ( D ), colistin ( E ), and aztreonam ( F ) or their combination with DNase 1, p-ASP, or DNase 1/p-ASP. Error bars represent standard deviations from three to five measurements. *Statistically significant ( p <0.05) compared to control. Abbreviations: p-ASP, poly-(d,l)-aspartic acid; LB, Luria-Bertani broth.

Journal: Infection and Drug Resistance

Article Title: Targeting polyelectrolyte networks in purulent body fluids to modulate bactericidal properties of some antibiotics

doi: 10.2147/IDR.S145337

Figure Lengend Snippet: Pseudomonas aeruginosa Xen5 biofilm mass formed after 24 hours growth in LB medium containing cathelicidin LL-37 ( A ), ceragenin CSA-13 ( B ), polymyxin B ( C ), tobramycin ( D ), colistin ( E ), and aztreonam ( F ) or their combination with DNase 1, p-ASP, or DNase 1/p-ASP. Error bars represent standard deviations from three to five measurements. *Statistically significant ( p <0.05) compared to control. Abbreviations: p-ASP, poly-(d,l)-aspartic acid; LB, Luria-Bertani broth.

Article Snippet: LL-37 ([LL-37, 37 aa]) was purchased from Peptide 2.0 Inc. (Chantilly, VA, USA).

Techniques:

Bacterial outgrowth from PBS ( A and B ) or PBS containing 50% pus ( C and D ) that were infected with S. aureus Xen30 and treated with ceragenin CSA-13 ( A and C ) or LL-37 peptide ( B and D ) with or without the presence of DNase 1, p-ASP, or DNase 1/p-ASP. Error bars represent standard deviations from six different pus samples (n=6). *Statistically significant ( p <0.05) compared to control. Abbreviations: p-ASP, poly-(d,l)-aspartic acid; S. aureus , Staphylococcus aureus .

Journal: Infection and Drug Resistance

Article Title: Targeting polyelectrolyte networks in purulent body fluids to modulate bactericidal properties of some antibiotics

doi: 10.2147/IDR.S145337

Figure Lengend Snippet: Bacterial outgrowth from PBS ( A and B ) or PBS containing 50% pus ( C and D ) that were infected with S. aureus Xen30 and treated with ceragenin CSA-13 ( A and C ) or LL-37 peptide ( B and D ) with or without the presence of DNase 1, p-ASP, or DNase 1/p-ASP. Error bars represent standard deviations from six different pus samples (n=6). *Statistically significant ( p <0.05) compared to control. Abbreviations: p-ASP, poly-(d,l)-aspartic acid; S. aureus , Staphylococcus aureus .

Article Snippet: LL-37 ([LL-37, 37 aa]) was purchased from Peptide 2.0 Inc. (Chantilly, VA, USA).

Techniques: Infection